PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009109881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 395aa    MW: 43881.4 Da    PI: 7.3183
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009109881.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box30.48.1e-101356340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    +r+C+++ +k++++fC  ++ +lC++C ++ H+       H++v
  XP_009109881.1 13 ARTCDNCLKKQAHWFCAADEAFLCQSCDTSVHSAnllarrHERV 56
                    689*****************************667888888876 PP

2CCT69.11.2e-23337380144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eK+ktR F K+irYe+RK +Ae++pR+KGrFvk++
  XP_009109881.1 337 REASVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGRFVKRT 380
                     9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.4E-111158IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8931158IPR000315B-box-type zinc finger
PfamPF006434.4E-91356IPR000315B-box-type zinc finger
CDDcd000211.05E-101458No hitNo description
PfamPF062031.1E-17337379IPR010402CCT domain
PROSITE profilePS5101715.299337379IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MKSLANCVRA KTARTCDNCL KKQAHWFCAA DEAFLCQSCD TSVHSANLLA RRHERVRLKD  60
STSPQQEAPT WYRGFTRKPR TPRGSGKRNN SSTFQDMVPE ISAEGQTDSS EVEGPLICQV  120
PVLGPMVVEP KIKFPTMRSG VMIDGHEDED KDESCLNGIF PTNMEVEDFA ADVETLLGHG  180
LDKESYTMEE LGLSNTEMFK KDEIEDKETK AMNMDIEIGD DDQGNRDGTL PFDLNYPQNA  240
YEEDAIKNVE SSGECVQAKE EKKKNVLMLS LDYDQVISAW GGQGLPWTSG GPPELDINIS  300
GSPVVSKVSK RDNGRKSRKK RRVGGCLPSS VVGDGGREAS VSRYREKKKT RSFTKTIRYE  360
VRKLNAENKP RMKGRFVKRT PLAASAGNSP LGVNN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109881.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD01e-173COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0D3BI520.0A0A0D3BI52_BRAOL; Uncharacterized protein
STRINGBra010994.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-169B-box type zinc finger protein with CCT domain